PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sp_142550_rptp.t1
Common NameSOVF_142550
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Chenopodioideae; Anserineae; Spinacia
Family GATA
Protein Properties Length: 327aa    MW: 36240.6 Da    PI: 6.3113
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sp_142550_rptp.t1genomeTBVRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA63.72.1e-20244277134
               GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                        Cs+C++tkTp+WR gp+g+ktLCnaCG+++++ +
  Sp_142550_rptp.t1 244 CSHCQVTKTPQWRAGPNGPKTLCNACGVRFKSGR 277
                        *******************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169921.4E-744327IPR016679Transcription factor, GATA, plant
SMARTSM004011.9E-16238292IPR000679Zinc finger, GATA-type
SuperFamilySSF577161.62E-14240301No hitNo description
Gene3DG3DSA:3.30.50.102.3E-15242275IPR013088Zinc finger, NHR/GATA-type
PROSITE profilePS5011411.833242274IPR000679Zinc finger, GATA-type
CDDcd002024.94E-15243300No hitNo description
PROSITE patternPS003440244269IPR000679Zinc finger, GATA-type
PfamPF003204.1E-18244277IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 327 aa     Download sequence    Send to blast
MECMEARALK SSFSSEIAMK TSNTQSILDD FWCISGLPSD DFSIDEFFDL PNEDNIDVDI  60
DGSEEEEKDS SSHSLSSHDP VDDSNSTNFS PDLAIPVDDV QELELWSHLM DDSIPEPTLA  120
CPNPILDGHK SKTGFSFLNR YEPVSKPVFI RVPCMPNPSA VPVKPRSKRP RTGNRSWVFN  180
SSPKTESSSS SSSVSSPVST LLFPPSVHDM RVLFNFGRPP MKKPKKKPVL ATSACENPPV  240
QRRCSHCQVT KTPQWRAGPN GPKTLCNACG VRFKSGRLFP EYRPACSPTF SSEVHSNSHR  300
KVLEMRKKKE TPESESDTGL TQTVLSS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010690771.11e-128PREDICTED: GATA transcription factor 7-like
TrEMBLA0A0K9QTQ30.0A0A0K9QTQ3_SPIOL; Uncharacterized protein
STRINGSolyc01g110310.2.13e-79(Solanum lycopersicum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G51080.12e-45GATA transcription factor 6